2024 Hopm interactor 7

Hopm interactor 7

Author: zyni

August undefined, 2024

http://tour.biocloud.net/database/v1/geneDetail/823405 WebArabidopsis thaliana gene ATMIN7, encoding ATMIN7 (ARABIDOPSIS THALIANA HOPM INTERACTOR 7); guanyl-nucleotide exchange factor/ protein binding. TABLE OF CONTENTS / OPEN CLOSE ALL PARAGRAPHS. ... In AceView, it covers 11.14 kb, from 15256022 to 15244884 (NCBI 7_1, April 2007), on the reverse strand. Links to: ...

Effector Triggered Immunity: NLR Immune Perception and …

http://www.khanglab.org/uploads/2/5/3/2/25329111/2012_park_et_al_avrpiz-t.pdf Webat3g43300: atmin7 (arabidopsis thaliana hopm interactor 7) AtMIN7 is an immunity associated Arabidopsis protein targeted by HopM1, a conserved Pseudomonas syringae … new hope baptist church nashville tn

Germplasm Detail - Arabidopsis

WebHOPM interactor 7;(source:Araport11) TAIR Curator Summary: AtMIN7 is an immunity associated Arabidopsis protein targeted by HopM1, a conserved Pseudomonas syringae … Web2 mrt. 2016 · 70. Interactor is a class which separates Domain Layer from Presentation Layer. In simple words it provides way to write business logic separately than code which is used for manipulate UI (by binding data to UI/ animate / navigation). So Interactor is mediator between Presenter/ViewModel and Repository pattern. WebConsolidated domain prediction view: cd00171 (CDD), a Sec7. Lotus Base uses cookies to allow user preferences to be stored. By continuing to browse the site you are agreeing to … in the driveway or on the driveway

At3g43300: ATMIN7 (ARABIDOPSIS THALIANA HOPM …

Hopm interactor 7

WebDescription : HOPM interactor 7 Gene families : OG0001057 (Archaeplastida) Phylogenetic Tree(s): OG0001057_tree , OG_05_0005925 (LandPlants) Phylogenetic Tree(s): … WebHOPM interactor 7 (ATMIN7); FUNCTIONS IN: protein binding, guanyl-nucleotide exchange factor activity; INVOLVED IN: defense response to bacterium, vesicle …

Did you know?

WebAtMIN7 is an immunity associated Arabidopsis protein targeted by HopM1, a conserved Pseudomonas syringae virulence protein. AtMIN7 encodes one of the eight members of … WebWelcome to our website! Call us at: 800-380-9586 Register Login Search Search Advanced Search All CategoriesProducts- Arabidopsis Antibodies- Algae Antibodies- Crop …

WebID Position(s) Description; Region: 205-234: Disordered automatic annotation. BLAST Add. Sequence: VSPGSSVVKDMPSSITNDSENGEISTDGQD Region: 510-540: Disordered … Webat3g43300.1/bfa-visualized endocytic trafficking defective1/brefeldin a-inhibited guanine nucleotide-exchange protein 5/hopm interactor 7; at3g43300.2/brefeldin a-inhibited …

WebHLB1 was found to interact with the ADP-ribosylation-factor guanine nucleotide exchange factor, MIN7/BEN1 (HopM interactor 7/Brefeldin A-visualized endocytic trafficking … WebName (RefSeq) HOPM interactor 7 KO K13462 guanine nucleotide-exchange factor Organism ath Arabidopsis thaliana (thale cress) Brite KEGG Orthology (KO) [BR:ath00001] 09190 Not Included in Pathway or Brite 09193 Unclassified: signaling and cellular processes 99995 Signaling proteins AT3G43300 (ATMIN7) BRITE hierarchy SSDB

WebGene ID: 110914954, updated on 28-Aug-2024 Summary Other designations brefeldin A-inhibited guanine nucleotide-exchange protein 5, putative HOPM interactor 7, putative …

Webdegradation of an Arabidopsis protein MIN7 (HopM interactor 7) that is required for cell wall–mediated defense (Nomura et al., 2006). Blocking the degradation of trans-Golgi … new hope baptist church newarkWeb6 feb. 2013 · Target of hopM1, a conserved Pseudomonas syringae virulence protein that directs the protein to its own proteasome-mediated degradation. Plays a broad role in … new hope baptist church new castle deWebConsolidated domain prediction view: G3DSA:1.10.1000.11 (Gene3D), a . Lotus Base uses cookies to allow user preferences to be stored. By continuing to browse the site you are agreeing to our use of cookies. in the drop-down menuWebdegradation of an Arabidopsis protein MIN7 (HopM interactor 7) that is required for cell wall-mediated defense (Nomura et al., 2006). Blocking the degradation of trans-Golgi … in the driving seat 意味http://webs2.kazusa.or.jp/kagiana/cgi-bin/subfunc.cgi?agi=At3g43300&name=ATMIN7%20(ARABIDOPSIS%20THALIANA%20HOPM%20INTERACTOR%207)&func=AtMIN7%20is%20an%20immunity%20associated%20Arabidopsis%20protein%20targeted%20by%20HopM1,%20a%20conserved%20Pseudomonas%20syringae%20virulence%20protein.%20%20AtMIN7%20encodes%20one%20of%20the%20eight%20members%20of%20the%20Arabidopsis%20adenosine%20diphosphate%20(ADP)%20ribosylation%20factor%20(ARF)%20guanine%20nucleotide%20exchange%20factor%20(GEF)%20protein%20family.%20%20The%20AFR%20GEF%20proteins%20are%20key%20components%20of%20the%20vesicle%20trafficking%20system%20in%20eukaryotic%20cells.%20%20HopM1%20mediates%20the%20destruction%20of%20AtMIN7%20via%20the%20host%20proteasome. new hope baptist church newnan gaWebBIG5 antibody; ATMIN7 antibody; BEN1 antibody; At3g43300 antibody; F7K15_150Brefeldin A-inhibited guanine nucleotide-exchange protein 5 antibody; BIG5 antibody; ARF guanine-nucleotide exchange factor BIG5 antibody; Protein BFA-VISUALIZED ENDOCYTIC TRAFFICKING DEFECTIVE 1 antibody; Protein BEN1 antibody; Protein HOPM … in the drop down menu new hope baptist church newtonville indiana