2024 Tlc domain-containing protein

Tlc domain-containing protein

Author: sozt

August undefined, 2024

WebTLC is a protein domain with at least 5 transmembrane alpha-helices. Lag1p and Lac1p are essential for acyl-CoA-dependent ceramide synthesis [ ( PUBMED:11694577 ) ], TRAM is a … WebA subset of Lass genes is predicted to contain a Homeobox (Hox) domain (19). In humans and mice, all but Lass1 have a Hox domain, in Drosophila only one of the four TLC-contain-inggeneshaveaHoxdomain,andnoHoxdomainsarefoundin yeast and plant Lass genes. The Hox domain is derived from homeobox proteins, which are sequence-specific transcription

Entry - *615175 - TLC DOMAIN-CONTAINING PROTEIN …

WebThe mammalian CerS proteins contain a number of distinguishing features. Prominent among these are two domains, (i) the T ram- L ag- C LN8 (TLC) domain, defined in a broad manner as a region of ∼200 residues also found in other proteins ( 7 ) and in a narrower manner as the Lag domain, a region of ∼50 amino acid residues ( 8 WebAug 6, 2024 · In plants, TLC is cataloged as a ‘lipid-sensing domain containing protein’ and its molecular function is unknown (Araport11). However, TLC was identified in a GWAs as … recycle teddy

Tlcd4 (TLC domain containing 4) - Rat Genome Database

WebM02B1.3 TLC domain-containing protein [] Gene ID: 178236, updated on 22-Sep-2024 Summary Predicted to be involved in several processes, including membrane assembly; phospholipid homeostasis; and regulation of membrane lipid … Webbuilding phylogenetic trees of all of TLC domain-containing proteins, on which they formed a distinct branch. Due to the large number of non-Hox sequences, representative species were chosen to build the alignment and logos. SMART motif analysis (18) was performed on mouse Cers5. Analysis of the sequence of the last 12 residues of the Hox ... WebAug 6, 2024 · Analysis of Darwinian fitness, root and leaf ionome, and TEM images revealed that Pb-tolerant accessions employ two opposing strategies: (1) low translocation of Pb and its accumulation into root cell walls and vacuoles, or (2) high translocation of Pb and its efflux to inactive organelles or intracellular spaces. update with null

Frontiers Genome-Wide Association Study Reveals Key Genes for ...

WebTRAM1 and TLC domain-containing protein. ... Description: Interval: E-value: TLC: smart00724: TRAM, LAG1 and CLN8 homology domains; Protein domain with at least 5 transmembrane ... 112-321: 6.19e-34: TRAM, LAG1 and CLN8 homology domains; Protein domain with at least 5 transmembrane alpha-helices. Lag1p and Lac1p are essential for … update with tablockWebMar 21, 2024 · TLC domain-containing protein 1 Protein Accession: Q96CP7 Secondary Accessions: A8MYP9 Protein attributes for TLCD1 Gene Size: 247 amino acids Molecular … recycle symbol for paper

"WebAug 7, 1998 · Thin-layer chromatography (TLC) is one of the simplest and most convenient techniques to separate small molecules. Of a variety of TLC separation modes, only size … " - Tlc domain-containing protein

Tlc domain-containing protein

WebDec 1, 2001 · TLC domain-containing protein 1 BLAST Add Sequence: RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE WebTLC domain containing 1 Synonyms 0610007A15Rik, 0610030G03Rik Feature Type protein coding gene IDs MGI:1915572 NCBI Gene: 68385 Alliance gene page Transcription Start Sites 5 TSS Location &Maps more Sequence Map Chr11:78068956-78071646 bp, + strand From NCBI annotation of GRCm39

Did you know?

WebGene: Tlcd4 (TLC domain containing 4) Rattus norvegicus Add Watcher Analyze General Array IDs Annotation Click to see Annotation Detail View Gene-Chemical Interaction Annotations Click to see Annotation Detail View Gene Ontology Annotations Click to see Annotation Detail View Biological Process Cellular Component Molecular Function … WebA family of membrane-associated proteins related to yeast Lag1p and mammalian TRAM has been identified. The family includes the protein product of CLN8, a gene mutated in progressive epilepsy with mental retardation. Mouse CLN8 is also mutated in the mnd/mnd mouse, a model for neuronal ceroid lipofu …

WebSep 9, 2013 · LC is performed in two different settings: on planes as thin-layer chromatography TLC and as paper chromatography PC (simple and cheap but out of … WebAug 1, 2002 · TLC domains could also act as lipid sensors, performing roles similar to, but distinct from, the multi-TM sterol-sensing domains of proteins such as the Niemann–Pick …

WebSummary Gene: Tlcd4 (TLC domain containing 4) Mus musculus Add Watcher Analyze General Array IDs Annotation Click to see Annotation Detail View Gene-Chemical Interaction Annotations Click to see Annotation Detail View Gene Ontology Annotations Click to see Annotation Detail View Biological Process lipid homeostasis (IBA) Cellular Component WebThe TLC (TRAM-LAG1-CLN8) domain is an about 200-residue domain found in a family of membrane-associated proteins related to yeast LAG1 and mammalian TRAM. It is …

WebNov 22, 2024 · The indicated boundaries are based on the alignment between all 5 TLDc-domain containing mouse proteins (Fig. S1). We hypothesized that these additional …

WebThe TLDc domain-containing proteins could influence the expression of key oxygen free-radical scavengers that, in turn, reduce the levels of ROS in the cell [ (PUBMED:28707022) … recycle tea lightsWebJan 1, 2012 · Phylogenetic analysis reveals that the Hox-like domain-containing family members divide into two distinct branches, CerS2, -3, and -4 and CerS5 and -6 ( Fig. 1A ), with the former using mainly very long chain acyl-CoAs (C18–26) and the latter using long chain (C14–16) CoAs. recycle tag pinWebZSWIM3蛋白抗体产品介绍：英文名称 Anti-ZSWIM3 中文名称 ZSWIM3蛋白抗体别名 Zinc finger SWIM domain containing protein 3; C20orf164; Zinc finger SWIM type containin update with inner join oracleWebProtein Domains Domain, Family, and Site Summary 1 - 2 of 2 Domain Details Per Protein 1 - 1 of 1 Transcripts Genome Browsers NCBI No data available Interactions and Pathways No data available Antibodies No data available Plasmids No data available Constructs No data available Marker Relationships 1 - 2 of 2 Show Sequences Overview ( 3) recycletech xt200WebMar 9, 2015 · Sterile alpha motif and histidine-aspartate domain-containing protein 1 (SAMHD1) is a recently discovered enzyme that plays a central role in nucleotide metabolism and innate immunity. ... dGTP. Small portions (2 µL) were quenched at various times by direct spotting on a C18 reversed-phase TLC plate. The TLC plates were … updatewithoutinputWebMar 21, 2024 · TLCD3A (TLC Domain Containing 3A) is a Protein Coding gene. Diseases associated with TLCD3A include Sclerosteosis 1 and Lung Cancer . An important paralog of this gene is TLCD3B. Additional gene information for TLCD3A Gene HGNC (29646) NCBI Entrez Gene (79850) Ensembl (ENSG00000167695) OMIM® (611627) UniProtKB/Swiss … recycle synthetic clothingWebTLCD1 → TLC domain-containing protein 1. Protein also known as : Calfacilitin . Gene name : TLCD1. Entry whose protein (s) existence is based on evidence at protein level. Show … update with or update on